DPCstruct | MC37439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 136 ± 39 aa |
| Standard deviation of domain lengths | 39.15 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02601 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2JP56 | 48-168 | SAAAELAVPDRHDVLHRVNVLAGRLANGLAQRARFGQERLARTADRLTSAMEQRVAAWRQEADRLGAQLEALSPLRVLERGYSVALG… |
| A0A7J2MA56 | 153-290 | ISEVKRWVAHNAQRMKKRVNETVFSRKELLKRVKGRKALKYPYELLRGAMFRFEETSGKFRRVALEQIEGGKKRLDVMEGCLRAMDP… |
| A0A1W1D649 | 30-166 | None |
| A0A2V7IML7 | 205-317 | None |
| A0A7C2Q3Y3 | 159-302 | None |
| A0A7V0MUK2 | 60-203 | None |
| A0A327JQX4 | 40-195 | None |
| A0A838G4L4 | 2-80 | None |
| A0A3D2GHS4 | 115-268 | None |
| A0A3C1BS99 | 4-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.