DPCstruct | MC37437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5LY83 | 12-105 | NYTVDPATKAQAQADIAEDGYWGVNQTSDRIIQFATALTGGDPDKIESMREAFKKGYAQAEKTWGGSLPEISQKTYDAVMEKFDKLA… |
| A0A7V5R8J8 | 19-104 | ISTVTPQEAKDLTGDDGYFGVDKTSDRIVKLAITIAGGDPSRIDAIKKGVDKGFQEALKAFDGKLPDISYDTYDAVMEKLDKWVSE |
| A0A1E7IJG4 | 84-180 | None |
| A0A840RKH5 | 138-224 | None |
| A0A3D5WIP9 | 35-124 | None |
| A0A661RWS8 | 3-98 | None |
| A0A366MKW6 | 107-198 | None |
| A0A1M4XHY4 | 90-215 | None |
| A0A1R1DBQ8 | 92-190 | None |
| A0A7G1G960 | 94-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.