DPCstruct | MC37431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5TUC7 | 121-196 | LTEPIGGKKAVPRIEVRTARQDADPLPPGQRVRHKSFGDGTVVSFGGSGGGQIIEIAFDSGEIKKFAAAYAPIETI |
| A0A7C5XTL1 | 5-57 | TGWRPGDRVRHARFGPGVVLSTRGRGPSLKLIVFFDRAGRKTLIPTVAKLEKV |
| A0A2E0RY34 | 712-788 | None |
| X1QB53 | 78-155 | None |
| T0D307 | 2-75 | None |
| A0A1E3H0Z4 | 431-499 | None |
| A0A1F3VP54 | 75-153 | None |
| A0A7V2UHY0 | 219-288 | None |
| K1YVY1 | 51-129 | None |
| A0A7K0W4E7 | 46-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.