DPCstruct | MC3743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258AH87 | 114-231 | MDVSAAESKIMHEITHGTEEKNPAVLAAALAFLRYRAGTEQPKRLRDLTGREDYRLDEYAYEDQFAARGGDHYMGKDYGGRGTELLT… |
| A0A425VT96 | 8-112 | FTIVHELMHAMDNVDEHFRTESKAFFDERTKGAAIVSLQRMMKNDAYRYNEMARIVDDAYSPYVYKDYGGDAYEVSSMGIQYLYTDP… |
| F5VGA5 | 252-369 | None |
| A0A1V6FXS9 | 528-648 | None |
| A0A7C6K995 | 353-453 | None |
| A0A0F9SNN7 | 1086-1190 | None |
| A0A1Z4JFH9 | 369-481 | None |
| A0A661PRA5 | 869-1000 | None |
| A0A1V5SJ06 | 317-419 | None |
| A0A1V5SG37 | 442-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.