DPCstruct | MC37427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.36 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3PLP0 | 64-129 | LVQRMAPQGLEVIVGGIRDEEFGPVVMFGLGGIFVELMRDVTFRKAAITKFEALEMIREIRGYQVL |
| A0A133UXX0 | 95-154 | GVETILGMNRDPQFGPVLMFGLGGIFVEVLEDVSFRIAPISESEVREMINDLKSSPLLRG |
| A0A1V6GPK8 | 1-72 | None |
| A0A2R6AAT8 | 15-81 | None |
| A0A7C3ZD16 | 91-151 | None |
| A0A7C1KIC0 | 356-422 | None |
| A0A1V5C2M9 | 117-181 | None |
| A0A212DLZ8 | 162-229 | None |
| A0A7J4HMH0 | 40-105 | None |
| A0A7W0LPH1 | 32-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.