DPCstruct | MC37426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 279 |
|---|---|
| Mean domain length (aa) | 188 ± 30 aa |
| Standard deviation of domain lengths | 30.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.85 |
| Pfam Score | 83.68 |
| Assigned Pfam label(s) | CL0123- CL0174- CL0388- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P3A0P6 | 6-191 | DPGQRLDEQLLGNRFNVSRTPVREALRLLAANGLVTLEPRLGAIVSRPTVSEIFDLFELVGEMEASAARLACERMTPDSRNRIADTH… |
| A0A645HDA8 | 2-131 | AMLEGECARSSASRASDKDLDSLRHIHEDLEHAASKRDIDAFFEANQAFHHALQQLADNRWLLHVIEDLRKVIKLSRHHSLFSEGRL… |
| A0A4R2JZD6 | 19-223 | None |
| A0A259KA57 | 42-249 | None |
| A0A485JMU6 | 6-177 | None |
| A0A6N2DRL8 | 166-395 | None |
| A0A850R2V9 | 7-132 | None |
| S9S327 | 353-565 | None |
| A0A377BYF1 | 9-203 | None |
| A0A1V5USD5 | 19-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.