DPCstruct | MC37425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2NU02 | 1-82 | MALCLACAGVPAFAGPPEVPPPEYQPMQFVDDEGCLFVRADVSGWTVWVQHLDAARQPVCDRVPTSLNLPDRAPEASAVDAV |
| A0A251WXJ4 | 1-97 | MSSARIIGFIAACLGGVAQIGYAQSQTPVPAEFPPASYDANQYVDSAGCVFVRAGMAGTVNWVPRLSRDRQQLCGFEPTIGAAIPSP… |
| A0A0F9FY84 | 2-98 | None |
| A0A640VUH1 | 32-138 | None |
| A0A7D7ZFV2 | 7-91 | None |
| A0A1Y5T777 | 1-98 | None |
| A0A1I1WE83 | 1-99 | None |
| A0A5Q4DMI9 | 9-91 | None |
| A0A858SV93 | 1-98 | None |
| A0A2G6J2P2 | 8-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.