DPCstruct | MC37424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 302 ± 45 aa |
| Standard deviation of domain lengths | 44.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A543GCW1 | 86-365 | VDIILDPPPAAIGPFQSDAYVITSEPAMPAIRAIASGGISGNWTVRVNIDATLVFEICRSIPPSMIKSIEFPAPAGGSAIDIDFGGA… |
| A0A1U7CTF2 | 1-328 | MPAISLIAPAAGTHFAIDGNGDMPVITAEARIVGLPTSTAASIPLTWTVRVRFTASVCPHGPARNINHPDIVQTAVGSTFRIPFSEV… |
| A0A1V9HH40 | 35-335 | None |
| A0A3E1EC88 | 148-482 | None |
| A0A815S101 | 67-349 | None |
| A0A2H6JVR4 | 13-365 | None |
| A0A831UZ44 | 363-717 | None |
| A0A1I4G2Z9 | 66-289 | None |
| X5PN52 | 391-643 | None |
| A0A817W412 | 46-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.