DPCstruct | MC37415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 143 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0PYD4 | 1-158 | MATELTTPSRTGVHPLDDAIRESLRGAHAHFARWSGRVARYHPDVAPHVGHPATLGDEDWADLATLLGPSATAALRGFGHTPPQGWE… |
| A0A1I4V8J6 | 1-140 | MSPLDCPVWSALTSDHRALAEGGPLAIRYAPEVAPFAVLAERTPGAFAALSALIPPEGWVMLHTPDALALPEGFVVERQAPLTQMVL… |
| A0A1G7B1R7 | 1-131 | None |
| A0A6I1YYR0 | 1-192 | None |
| A0A1E3GYP8 | 173-324 | None |
| A0A4Q5LRN2 | 1-139 | None |
| A0A1Y2JQ94 | 9-146 | None |
| A0A6B1PV74 | 3-129 | None |
| A0A4Q3GF87 | 225-362 | None |
| A0A519W2V5 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.