DPCstruct | MC37413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8RU48 | 1-151 | MPAGDIDLIAPLGTIDAGEAGIRVSGNVNIAALRVVNAANIQTQGKSSGVPLTASVNTSAMSSASAAGAAASQAAEDAARSQQAAAR… |
| A0A4Q7G475 | 7-155 | LPTTGAGIARLNPIPEVQPGNVDLIAPLGTIDAGEAGIRASGNVNLAALQIVNAANIQVQGRATGIPVVHAPPVAALSSAGNATAAT… |
| A0A556UPV6 | 743-913 | None |
| F4GVZ6 | 1-153 | None |
| A0A5B7QXE8 | 760-880 | None |
| A0A2Z5E7J4 | 393-505 | None |
| A0A4P5RBE4 | 97-211 | None |
| A0A1G3XXV6 | 104-219 | None |
| A0A484PP59 | 609-781 | None |
| A0A1M3D5L9 | 354-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.