DPCstruct | MC3741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R1RG98 | 2-95 | LTGIIVAGALWLAIGTGQSGSRIRMGYAKSAARLNRDDDRYWKWGIFYYNPDDPAWFVEKRFGIGWTSNFAQPASWMLLVGLLFILP… |
| W4AJ07 | 29-121 | IPIVLIIIAFIILYALALSFWAGQGGSRLEQSADHSNFRPVHDDDKWLLGMIYFNRKDPNLIVEKRFGVGWGLNFGHPVCWLIFLGI… |
| A0A1E9HP84 | 197-276 | None |
| A0A852U4F1 | 5-99 | None |
| A0A1V2PM19 | 227-328 | None |
| A0A6Y7C549 | 136-231 | None |
| A0A0B1ZYQ3 | 104-206 | None |
| A0A4V3CZB6 | 268-355 | None |
| A0A402ANZ4 | 1-97 | None |
| A0A4D4J4W7 | 18-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.