DPCstruct | MC37407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 144 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.21 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0193- CL0061- PF14805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HZ49 | 1-126 | ITPANVDTVTREAVNQVIGLLDSGALRVAEKIDGQWVTHQWLKKAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQKEGFR… |
| A0A848EMH5 | 19-148 | ETLKKRVTSLHQGNAKLQDQELRSLLSEFIYALEKGGVRAAEDAQGEWRSNQWVKQGILSLFKHCKNSRQGKHGTSSDVLPTRSIEN… |
| A0A1Y0D1G3 | 3-125 | None |
| A0A6A5LCB9 | 3-155 | None |
| A0A6A5L6U4 | 4-148 | None |
| A0A4Q5ZQC7 | 8-134 | None |
| A0A357NRD9 | 79-233 | None |
| A0A7J7AGT0 | 389-555 | None |
| A0A6L5DK67 | 445-594 | None |
| A0A7R8WVR1 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.