DPCstruct | MC37402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 171 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7LEX9 | 118-287 | QMTQSTEKDQVESYISSSLKSEFSRIILDVESKAAGTHEHPLASLAMETQKLLRKDSSLFMPILSQWYPRATAFAASLLHKVYGNKL… |
| A0A0K9PNU5 | 1-172 | MQSAPGSDRDLIEAYISSSIRISFSRVLHYVEAKTDSSHEHVLACLAEETKKLLKTDSTIFMPIFSKWHQLAPVASASLLHKLYGNK… |
| A0A2T7CYW2 | 524-697 | None |
| A0A835UGW1 | 486-655 | None |
| B7ZXY1 | 25-199 | None |
| A0A287HTC5 | 323-490 | None |
| A0A446MKK9 | 37-202 | None |
| A0A7J0FUR1 | 473-620 | None |
| A0A0A9DUI8 | 216-388 | None |
| A0A3L6SBZ5 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.