DPCstruct | MC37401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 246 ± 26 aa |
| Standard deviation of domain lengths | 26.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9W6N7 | 1-222 | MDPAASTSAAESSRDVVAAMPDSPPRRAARHRRAQSEILLGAALPDDIGFDADLGVVGEVGGGGDDYEEEEDEDYDEEGAGGSRMFE… |
| B7EPB8 | 1-236 | MDPRFPPPAPSGGAPPRGHHRRAHSETFIRLPDADLLLDPDGEFGFSDLDFPSLSDDSPAASDPTPPPPPPALPQAAPRPPGGAHLR… |
| U5D3Y5 | 3-305 | None |
| A0A6P5XHY9 | 46-285 | None |
| A0A0D9XPC5 | 1-263 | None |
| A0A6A3B1S9 | 1-265 | None |
| A0A804N6U0 | 1-223 | None |
| A0A6P4DQC7 | 1-247 | None |
| A0A162AB25 | 2-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.