DPCstruct | MC37399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0BVP1 | 83-187 | AIDLWIESRARAEAAIAAGKKKRKRLFKTRVPNGRVEFMMKHRFSSTEPLSDEELANCSASYRQLYGIAKFIDRKMNDYEQLLIDQY… |
| A3AYQ8 | 18-119 | LWLERQKANAEAAAAKKKKRKVFKCRVPNSLVEVMIARPYKCVDHDRSQEELAELTVSHRQGYILRKFIDEKKMKYEQTLIDRYVKQ… |
| K3ZZW5 | 5-94 | None |
| A0A0E0JJJ4 | 5-108 | None |
| A0A3L6RF99 | 13-117 | None |
| A0A811PIT8 | 58-177 | None |
| A0A835BRF3 | 59-191 | None |
| C5XA86 | 45-175 | None |
| A0A2T7C406 | 43-162 | None |
| A0A1Z5R4G0 | 14-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.