DPCstruct | MC37391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 187 ± 32 aa |
| Standard deviation of domain lengths | 32.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2WAB3 | 14-151 | FLRRHSTIVILVISLAVSFSWEAFKMYRERTFGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYENKLWNTEYFFFDGSSCHVA… |
| A0A1G4MHK3 | 16-188 | RIYHTIITRKLMVYVVILEMCFCCWLIWASIKNGMYPAIVAIILNGIPIIFVSGFGANRLEQTLIMTRINKLYFLREVVVMRPGLEM… |
| A0A7I9EUX4 | 363-580 | None |
| A0A7I9EVD2 | 223-442 | None |
| A0A1G4IZE1 | 23-198 | None |
| A0A1G4KGY5 | 21-219 | None |
| A0A1G4IZB3 | 7-201 | None |
| A0A1G4ISV6 | 4-103 | None |
| A0A7I9D9W3 | 96-289 | None |
| A0A1G4ILA2 | 76-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.