DPCstruct | MC3739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9R6Q3 | 58-174 | REALERLLGNSGITLQWIGWDRRGDLAADYATDLLRLRGGQSASDGPGKLMLDGVVTRIDRDSFTFDGRIDIIDTPDIGRVCRREGQ… |
| A0A6M0CM23 | 20-143 | QNIEEKLLGNHMLSLQWISWDYFGKATITKSEKANEYRIIGEQKSKENSDYLKIEGTLNPVSETELTFTGIIETEISHINNGEPCRR… |
| A0A0M9DVA5 | 71-188 | None |
| A0A7C3QRF5 | 4-109 | None |
| A0A6L5XM18 | 420-530 | None |
| A0A7T9JVB0 | 5-146 | None |
| A0A3B0YHP8 | 34-163 | None |
| A0A846QIP4 | 123-240 | None |
| A0A3M1LDH1 | 409-533 | None |
| A0A6I4SK69 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.