DPCstruct | MC37388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377APH2 | 47-116 | VRKGELLFSGPPDQPYLNIEAIRNPDATEDDVIAGVRVTGLADEPKAEIFSDPAMSQQAALSYLLRGQGL |
| A0A1B6NSX9 | 1-72 | MIIQTGEVQFNGPIDQPLLLVEAIRDPAKTDDDVIAGIRIDGAADAPSINLFSEPAMDQQGVLSYLLTGFGT |
| A0A376YEP4 | 152-220 | None |
| A0A3S0VTB5 | 1-78 | None |
| A0A2X2U9F4 | 152-221 | None |
| A0A536VPD4 | 826-905 | None |
| A0A2X1QLZ4 | 61-130 | None |
| A0A336N7J6 | 131-189 | None |
| A0A448QSF3 | 40-98 | None |
| A0A485EW31 | 123-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.