DPCstruct | MC37386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 179 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370U004 | 1-170 | MDHLPPVLNPFEPLDIPYLGGTEVGYDGLGYEGYPSRQGWDVDLLKHGDLQGRTILEAAHFLQDWLYFGMLRETLRAVPDDPPLELD… |
| A0A1C1CEX5 | 1-163 | MDHIPLPPSAAPPVVMYVAGDYEPGDFASFPERKGKGRMLDTPAFSQARPEEWQAFFQTWLYFGCLVEIFKVVGLEVNQNRFVRETE… |
| A0A438NFH3 | 1-157 | None |
| W9XXJ6 | 3-188 | None |
| W9Y2X2 | 1-188 | None |
| A0A0U5GHJ5 | 11-183 | None |
| A0A0D2IEW2 | 1-184 | None |
| A0A0G2DZ22 | 5-171 | None |
| A0A093Y1I5 | 16-191 | None |
| A0A146F3R6 | 3-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.