DPCstruct | MC37382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 230 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370TS78 | 1-234 | MEPIPLRALTVLLNYEFMVSDPRFHGVRFLLSSVADATTLPTIKGRIPDLFKNLPATIRKQSLNQFVTFEEPLPADIASTTILIHPD… |
| M2RTB1 | 1-251 | MATPAFPPDLVLDVHDLAAIILNCHFQLEPKFAKTKLLEINRGTSSLQTLPDHILAPQWDMPTPGQRRVAYILRDESSAPDRVTIDT… |
| A0A1L7X0P5 | 54-289 | None |
| A0A4Y9YDI8 | 12-257 | None |
| A0A4Z1H375 | 68-305 | None |
| A0A4Z1IL45 | 190-413 | None |
| A0A4Z1JFM9 | 3-228 | None |
| A0A4Z1J7N2 | 341-568 | None |
| A0A0W0FA06 | 1-219 | None |
| A0A6G1JQZ8 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.