DPCstruct | MC37379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8FVV8 | 24-88 | LENALKQTVMFERTKDVDYIYSAKVKSEHWQIRLGDFPAEPLYFFIINGKEIAEFNDWPTINWKR |
| A0A523BV82 | 384-447 | LQAALALPLSWSATGNPDVPWKTEVDGNSWQVRLNDFPDEVMYSLTVNGEVAGDFHDWPKMWER |
| Q5YWH4 | 2-59 | None |
| A0A7W0Y389 | 1-65 | None |
| A0A2M9LDB5 | 11-75 | None |
| A6UMM3 | 6-71 | None |
| W0BI56 | 23-85 | None |
| W0BHJ9 | 3-70 | None |
| A0A5C7M2E7 | 10-79 | None |
| A0A840AB19 | 98-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.