DPCstruct | MC37378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7MP92 | 1-104 | MSNGLNANMLDQLDIDPEETNEWLEALGAIQEQDGNERVQFIISQLVEMARQSGAAIPFSANTAYINTITVEQQPKYPGMTTIERKI… |
| A0A7C7CGA0 | 4-109 | VYKDADPQETREWIESIEDTLEEHGSERTRFLLEELIDYAQAKGARLPFNTNTPFINTIHPEKQPEFPGDRDLERRIKSLVRWNAMA… |
| A0A1F9N679 | 2-115 | None |
| A0A6H2FPK2 | 5-112 | None |
| A0A643G580 | 42-145 | None |
| A0A1A9Z120 | 4-113 | None |
| A0A3E0PRJ3 | 1-118 | None |
| A0A515HJD5 | 1-121 | None |
| A0A7W8CR56 | 8-117 | None |
| A0A447QCH5 | 3-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.