DPCstruct | MC37376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432QQV8 | 34-251 | EKGLMDCATCHDSHNGADRKRLIRYTLEGDSALCTACHTAQAKVIATDHDMRVVKKNFKNALGKDVLKDGVCSACHVPHRAKDDILW… |
| A0A1X7MMJ6 | 29-251 | SGKPNTPALLQDHKNGKLCENCHAGKQRVVGTEHDFRVTTDETENQQEETPHQSGVCGSCHTLHRGDPKNIFLSAAVESEVKDRDKT… |
| A0A1G2ZXT9 | 233-495 | None |
| A0A832FHQ8 | 962-1200 | None |
| A0A3C1BQF9 | 96-317 | None |
| A0A7C4C9B1 | 4-203 | None |
| A0A3D5NZ85 | 20-198 | None |
| A0A1F9FDD7 | 190-423 | None |
| A0A3M1X770 | 156-325 | None |
| A0A7C3E7I8 | 447-671 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.