DPCstruct | MC37374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02538 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7MLM3 | 1-97 | MPANSQSITEEGLLSAGMKIVSKGEFLEQQVSEWLTGSDYPTRNVEQNIADLQAQIAANNKGQLELANMVAHYSLATVLSYMQHVQN… |
| A0A7X8D6N0 | 38-131 | MPPGSRTVMEEGVLIDNFKLVEKGEMRAEALRELLSSGPYPARNIEQNLADLRAQIAANEKGVQELQRMVQLFGLDVVQAYMQHVQD… |
| A0A6L9ZS97 | 422-515 | None |
| K0VY55 | 182-275 | None |
| A0A2H2J9A8 | 1-102 | None |
| A0A482UKK8 | 29-142 | None |
| A0A0M3IQS8 | 2-94 | None |
| A0A1I8GUT3 | 772-873 | None |
| A0A7S3DHF1 | 404-510 | None |
| A0A6I9P7W3 | 276-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.