DPCstruct | MC37372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 330 ± 25 aa |
| Standard deviation of domain lengths | 24.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.24 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF05090- PF04134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7WYS9 | 197-514 | ANRLQVAYDDRCNLCDRTVTFVKAVDLFRRVHLKPLSKNIPWLIEVGIDPDDARKDLYAVDVSSGNAVKGYEFYVLLSKHVFLLLPL… |
| A0A1X7MK92 | 1-341 | MFYDGDCPLCNRTATIINHFDLLQAVAFKDLQTQADTAPQLQKYDQQVLLTDLYAVDLEGRVYAGVDTYIQVFQKMRYLAVFAWLMR… |
| A0A831RI62 | 1-381 | None |
| A0A7I8CC30 | 335-650 | None |
| A0A4Q1W0W1 | 325-648 | None |
| A0A2E1KLJ0 | 295-642 | None |
| A0A023BSK8 | 253-587 | None |
| A0A0L0D767 | 257-575 | None |
| A0A518AT61 | 391-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.