DPCstruct | MC3737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561RP71 | 5-115 | TPLYPDVVRAGSLRNALQDVADRAGYGLDVELTTSPGWRYVAAKVAAGGRSANVLMALDVRSFAVGCWAGTVHMADGSTDDLPEVAG… |
| A0A317KE92 | 1-123 | MSDVSTALGVRLYPDLVERGGLAAALADCAALHQLDIGRLSAPENGRSRYTHAEMSCDRGVVRVGLGAEARYFMIDISGDGRVRAHG… |
| A0A545AFA8 | 12-113 | None |
| A0A517W3R4 | 14-122 | None |
| A0A1C6SI52 | 11-121 | None |
| A0A177QNR0 | 11-106 | None |
| D9W4W2 | 9-105 | None |
| A0A2I0SH99 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.