DPCstruct | MC37368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 311 ± 39 aa |
| Standard deviation of domain lengths | 38.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7M9V5 | 2-284 | RPNPVLTEGQFMENNIKATLDSFNLNNINIIDYKVKLDASKDIESWGTKNHFENIPVWDREYLIDGYRQLQGIRPYYTFNSVDEDRY… |
| A0A4Q2WIW1 | 2-260 | AYNLENVERKDFPAGRTLTAQDIADNRATIDNIRLWDWRPLQQTYSQLQEMRLYYEFKNIDIDRYNIDGRYRQVMLAIREMNQDQLS… |
| A0A0K2RRB3 | 2-332 | None |
| A0A355A5D9 | 29-359 | None |
| A0A7V9TI54 | 78-384 | None |
| A0A2D6D2I4 | 460-789 | None |
| A0A1D3RPL3 | 9-339 | None |
| A0A7J3LXR1 | 389-736 | None |
| A0A4D4KB26 | 254-582 | None |
| A0A336P3K8 | 2-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.