DPCstruct | MC37366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 235 ± 34 aa |
| Standard deviation of domain lengths | 34.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9U2A6 | 16-290 | LLKPLERRDNLCIMFFPYQSIQGIPAPRVVVELPRYGLSFFVDDDGDLQSSNMRDMVYDKNQSIGTMLGLVNQLVLRPKGQVVEHLI… |
| X0GK95 | 122-385 | ILNPLEAPLGLHLVYSTAKSATEIQIPSLRLEFLLRSGEPFIESRQFRDMHVDPNQSIGTLMGFKSKLVLSSSREPPSRMVLIPEGD… |
| A0A5N6E6D4 | 629-891 | None |
| A0A822DW11 | 18-262 | None |
| A0A2K0UV93 | 3-212 | None |
| A0A1J8PVJ7 | 309-572 | None |
| A0A1J8Q2Q5 | 352-607 | None |
| A0A821RGS6 | 53-316 | None |
| A0A7R7WCC1 | 3-206 | None |
| C4JQK6 | 436-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.