DPCstruct | MC37360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3KGA5 | 1-175 | MPDIDYGEVGSNIVYTSLHAGAATADPKKNPEPHGRAYAVTPPGHTVEYLERPEFPPRRNGTVKLSDTASFLEYWKRQHSADSYIYG… |
| A0A124JUF9 | 12-165 | RDSIAAASDHLRGLIVTIKDPRDGTEAPALLGDKVEIISPSQLDPYRDIPLRRTGTATHTRLDSFIDHVNRFKGGNSAVFAVDNMEA… |
| A0A0J9GTT8 | 12-191 | None |
| A0A318E0T0 | 5-139 | None |
| A0A653RMU4 | 6-136 | None |
| A0A379FFI4 | 1-125 | None |
| A0A2A6FQV9 | 10-146 | None |
| A0A7Y6AB20 | 5-153 | None |
| A0A1F3INT2 | 1-132 | None |
| A0A7C9NVS9 | 2-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.