DPCstruct | MC3736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08962 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0P6S9 | 2-88 | PEPHTTDWSVRLRLVEVGDLTQAHAVLDTGVNLIEVDAEAHRSAQDPADPAIGDELAVGRALAALGQQLIHRGSTAAEAVESARRRD |
| A0A317K7S7 | 1-90 | MVAVATVKRWSVEINIDEHSDERRTWAEARLHTNDATDLRGTGTAHRNPYDREMPEIGDELAVSRALADLAEKLPIASVADVEQLTL… |
| A0A512D0Y2 | 83-170 | None |
| A0A1V2IA59 | 3-96 | None |
| A0A7W3VS96 | 1-88 | None |
| A0A7Y6CPM5 | 20-106 | None |
| A0A7W7LF70 | 39-113 | None |
| A0A1H4LV21 | 217-306 | None |
| A0A3D0SA40 | 1-85 | None |
| A0A5P2VGT6 | 112-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.