DPCstruct | MC37359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3K263 | 1-113 | MKAIINLSTFGKKKEMLKAVSEIIRLCNLYPEPTKEHTFLPRTHILIDVQDEFFKHEHNPGRDALFRAMWRMFIIEYEHDHYYQYRI… |
| A0A0F9PG77 | 34-155 | LSHVMLRGLMRDFVIDKVKKPLRKAIITLANRYPLPTRENCLNQNSHILLDKRDEFLSYEGNSSPSKLFAALFRIFIAEYEHDPYYR… |
| A0A6M3JPU8 | 3-104 | None |
| A0A6M3K698 | 11-108 | None |
| A0A6M3KHV3 | 41-157 | None |
| A0A6M3IPY2 | 13-123 | None |
| A0A6M3XUZ4 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.