DPCstruct | MC37352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3JJ47 | 1-103 | MTSTRQRRGSQHERATAAAFGGERIAGVGRRDVSCERWSIECKSKASLPKWLTGAMEQAERQRRPDTVALVVLHALGERHDEDLVVL… |
| A0A0C1S3X1 | 11-93 | GKHTESAIAKRLGGKRLGILGNDDVQAGAFSIEVKDRVKFVGTGFMAQAVRNCPQDKTPLVIVHTTGARHDDDLVMMRLSDLG |
| A0A522F1K8 | 9-80 | None |
| A0A6I1Z9R1 | 1-101 | None |
| A0A0N8GKX6 | 1-96 | None |
| A0A2U2SB84 | 44-150 | None |
| A0A6M3XUC9 | 65-155 | None |
| A0A1N6J035 | 1-99 | None |
| A0A6M3M0P6 | 21-108 | None |
| A0A0F9TTR2 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.