DPCstruct | MC3735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 138 ± 35 aa |
| Standard deviation of domain lengths | 35.07 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9RCX8 | 65-162 | TVSAFGPTGDRITYYSLDILPREPAKGYRILRNGQPVPGQLEIHSGLPGDAGYNDFVQITEVSVGDGYVANSLQSASEVEAAIAAGD… |
| A0A317K3Z9 | 46-192 | RRKSARAFISIPLALLLSILGTGVAHAASMNGAAGQMPAFYDGTQFTVNMKEMPLNASAALIAHNPSINMIFASNDLDEEQDFIPVI… |
| A0A534HTK4 | 82-197 | None |
| A0A399D0A3 | 77-172 | None |
| A0A3E0DQ89 | 15-165 | None |
| A0A534KA06 | 1-107 | None |
| A0A7Y0L6Y7 | 90-203 | None |
| A0A2V8ZW14 | 447-602 | None |
| A0A4P9W3K8 | 54-165 | None |
| A0A6J4TJ26 | 445-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.