DPCstruct | MC37344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 490 ± 93 aa |
| Standard deviation of domain lengths | 93.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5AAY7 | 14-491 | LTFTTTLQNGGLLVTFLALFVTFAGTCCWTIVSFAIHQMLSQQAPQRAIYHQQQAILRNSGTSAAAFWRLSRMTWAWRRHNSVASFK… |
| A0A0N0DDH9 | 297-834 | ATLTLSSRDASLLAFIAAFVTVLAIRLWLIISFATHQLSATGGKHDGLYYQQQVILRNIKSAPAAAWLFLQQAWYWRGIARSSLART… |
| A0A0C4BKY9 | 32-464 | None |
| A0A1Y1ZWC6 | 1-407 | None |
| A0A420NRF7 | 2-394 | None |
| T5A6N0 | 38-446 | None |
| A0A0C9LYQ4 | 23-567 | None |
| A0A0S6XPT6 | 118-728 | None |
| A0A194UPM5 | 15-646 | None |
| A0A2V1D1T8 | 1-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.