DPCstruct | MC3734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317JU21 | 1-138 | MTNAKLSLAVLARVAEFLQELPEADVADLAAGRARLAVVPFGASAPRVPAARRPSRTVGAHRPAAPALDPDGARATLTAMGSRDEGT… |
| A0A543DLH9 | 17-145 | LPSPPLAIALQKAVALLESLSREQLEDIASGAGKLEYRPGPVRPIRREVVHRPSGVDVAAAAADINRLVTPAEVADYLQSRSAEFTV… |
| A0A6N8W3L1 | 1-131 | None |
| A0A841BK73 | 1-136 | None |
| A0A7Z2MA45 | 1-131 | None |
| A0A374C1U2 | 2-117 | None |
| A0A2I2L1Y5 | 42-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.