DPCstruct | MC37334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 175 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.52 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0318- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9WXE8 | 35-236 | YTADTGAKVWSIKTGSAIDSVPVTYTVNGEQYVLTPVGWGSGSRLFAPAWTMATPESKRGPARLLAFKLGATTPFPTPPDIVPPVPK… |
| U2FNG3 | 3-184 | YRATDGKKLWESPANSGVMAAPVTYMAGGEQYVTFMVGWGGAFSTFAGGQSKNAGVRPYAEVLTFKIGGDEKLAEPDFPPLAKPEPP… |
| A0A6N9BW02 | 554-734 | None |
| A0A832R6D3 | 373-524 | None |
| A0A2D4SC45 | 661-842 | None |
| A0A350QBG7 | 175-339 | None |
| A0A2V8M342 | 236-408 | None |
| A0A1B3N5U6 | 424-599 | None |
| A0A2A4FRX7 | 69-255 | None |
| A0A3B9YYP6 | 213-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.