DPCstruct | MC3733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6ZEE4 | 400-472 | GGSDGIRNPAQDKLLTKGDIQKLKDAGYDIHDLKGYGNAANRDLYKDRGGNIYVKPKGGSGEGESLNININDL |
| A0A0R3EYX3 | 1-78 | MCQAPSEGPSGRNPAQDKLLTKGDIKKLENAGFDVHELKGGKNASKFDLYKDREGNIYVKPKGGRGEGDPLGININDI |
| A0A1C4G7W5 | 27-104 | None |
| A0A844CEJ1 | 195-269 | None |
| A0A8B4E1Z7 | 30-107 | None |
| L8JSJ1 | 380-455 | None |
| G5JB99 | 1-72 | None |
| A0A829MBG4 | 325-394 | None |
| A0A6I7Q999 | 1-62 | None |
| A0A7T9QKF5 | 39-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.