DPCstruct | MC37323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 170 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.92 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0110- CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7M9T6 | 28-151 | MTYNAEEQVQAHKNQATYLVQLASRTTPKGLHCLSMRLTADYFARLPEEQELPNKQKLHDPDIYHFAVFSDNILACAVEPKKIVFHI… |
| A0A1D6N4Q9 | 61-215 | YKAQDSHYDLSTTIVTLKNHALALEERAKAAIVQSAEFGQLAAESFPKNLHCLTVKLTEEWLRNPKHRSRSEENRNSTRLVDNNNLY… |
| A0A1D6FM54 | 3-180 | None |
| A0A388KR06 | 42-257 | None |
| A0A2G2XCG5 | 5-145 | None |
| A0A4Y7LA20 | 129-317 | None |
| A0A1R3IWD3 | 719-870 | None |
| A0A6A2XIL8 | 38-252 | None |
| A0A4S4DP00 | 298-456 | None |
| A0A2T7ECE5 | 237-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.