DPCstruct | MC37322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.15 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7M9D5 | 3-62 | CLTNNGHGLWETLFYRLFSRVQVYKTRSEMQLSLPCISEGALSLDDGMVRSNGVFTLGSR |
| A0A453EJ19 | 185-254 | MILMDQAYLSCLTPHGHGLRETLFYSLFSHLQVYKTTADLRRAIPFINDGAVSLDGGILRPNGSFCLGDR |
| A0A2G3CWT4 | 26-95 | None |
| A0A1S3YQQ7 | 1113-1179 | None |
| A0A3Q7FLQ5 | 93-162 | None |
| A0A3Q7FN09 | 637-706 | None |
| A0A7J0ECF5 | 145-214 | None |
| A0A540K8L6 | 1193-1260 | None |
| A0A5P1F3N4 | 315-384 | None |
| A0A4Y7LGZ6 | 327-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.