DPCstruct | MC37321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 17.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.17 |
| Pfam Score | 86.74 |
| Assigned Pfam label(s) | PF04563- PF04561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7M408 | 1-126 | VALDYIGKRGSTVGITKEKRIKYVKEILQREMLPHVGVGEYCETKKAYYFGYIIHRLLLCALGRRPEDDRDHYGNKRLDLVGPLLGG… |
| A0A1V5ACV0 | 258-386 | MEEALEKIGVRVAAGQAKEYQKKRAAYVLDRYLLPHIGVDEKDRYAKALFLSRMAEACFELALGKRGEDDKDHYSNKRLKLSGDLME… |
| U5DGA1 | 161-274 | None |
| A0A2N0QCX5 | 1-170 | None |
| A0A2A2KTH8 | 162-290 | None |
| A0A3L6GAM4 | 120-261 | None |
| A0A1A9X296 | 27-122 | None |
| A0A7J7L0H8 | 36-145 | None |
| A0A7J7LFH5 | 84-186 | None |
| A0A7J7MU65 | 68-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.