DPCstruct | MC3732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 10.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9AYS6 | 1-79 | MDKKTLDWLEDSDPVIRFRLHRDLLKSDPKIIQSSQNEIEKTGWGAAFLSHQNPDGHWGLAYYLPKFTSTHYTLLMLRM |
| A0A1G5YRB2 | 1-79 | MSLPVIDWLLASDPSIRWQVMRDLLDAPEPVWRAERAKVETEGWGSRLLSHQDDDGQWAGGAFVPAGFDAREWSERGQP |
| A0A0H3D772 | 1-68 | None |
| A0A2V7U701 | 9-102 | None |
| A0A0D1C8Q2 | 4-67 | None |
| A0A352FEN4 | 3-90 | None |
| A0A1Y6F8B2 | 3-82 | None |
| D5UGI4 | 10-73 | None |
| A0A6J6E091 | 1-60 | None |
| F6FUY5 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.