DPCstruct | MC37319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 509 |
|---|---|
| Mean domain length (aa) | 207 ± 46 aa |
| Standard deviation of domain lengths | 45.94 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 84.31 |
| Assigned Pfam label(s) | CL0539- CL0291- CL0402- CL0196- CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660SGY5 | 2-129 | SYIDQAFRHPSFTHEKGWDRSRSNELLEYLGDAVYELIVRKLILERYPTEDEGWQTERKNRYTNQKFQAKLARRFNLGKRLKLGRGE… |
| A0A7J7LYE4 | 2-194 | AVESSLGYKFLYKGFIVQAFVHPSFNKHTGGCYQRLDFLGDAVLDYLITPYLYSVYPKLKPGQLTDLRSVTVNNNSLAHVAVTRSFQ… |
| A0A1G6ZRF4 | 16-219 | None |
| A0A1R0GTX6 | 33-199 | None |
| A0A369JM53 | 9-251 | None |
| A0A4U0VNX1 | 4-214 | None |
| A0A4U0VTX6 | 950-1207 | None |
| A0A4U0W0N3 | 20-190 | None |
| A0A4U0VVM9 | 14-226 | None |
| A0A4U0VYU1 | 6-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.