DPCstruct | MC37318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 169 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7ECL3 | 8-187 | PHQISLFRSQITTRRFNDQSLRILESLLVFKDVKSQIETRSDLKQFLRLESLSIFHEIKYKTVYQKLFILQFFVRAFALIGDTESCL… |
| A0A7J7LWB8 | 6-183 | VVETISLFRSQLQHRRFDDETLRILESLLISKDVKSLLEMRSCLRDFMRSESVYVLKELLEKPVDQKLTVLEFFVRAFALVADVESC… |
| A0A6A6M4U2 | 56-237 | None |
| B9S276 | 2-172 | None |
| A0A498IU89 | 712-907 | None |
| A0A5A7PCQ0 | 85-272 | None |
| A0A0E0R350 | 11-189 | None |
| A0A1P8AU91 | 2-159 | None |
| A0A5J5S660 | 1-179 | None |
| A0A4P1RNL8 | 422-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.