DPCstruct | MC37312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4EM74 | 25-137 | PKFSMAHAELPFPICGNCSKIRDFQGNTGFACHYEDDQKVVQKFGTPTNNFPDCLPETYMLTGDINYLCCFWSPELGCTALIGRQLH… |
| A0A0Q9WC89 | 4-138 | RTVASGQSNNVCVLCDEYVYKNCIVARTGMAAHSSTAWDMVKVERLTVGEQHESQFNKCVKGYKITDDLNKFVCFWSAELGCQAIAN… |
| A0A6P4JPL4 | 21-157 | None |
| A0A6P4EHM2 | 17-136 | None |
| A0A6I8V5Y6 | 22-152 | None |
| A0A1W4VLB3 | 2-115 | None |
| A0A0Q9WQ63 | 26-156 | None |
| A0A0Q9WDH0 | 28-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.