DPCstruct | MC37311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 214 ± 37 aa |
| Standard deviation of domain lengths | 36.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 84.97 |
| Assigned Pfam label(s) | CL0273- CL0229- PF03105- CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6UJ99 | 1-164 | MKFTYQLEYNAFGPWHDGYIQYKRLKRLIKQQRHNLAATEEGATITPDDAWQEFEKALCAEMDRISTYFYNIYARLTTSVKQHLAPM… |
| A0A0Q9W8H5 | 1-222 | MKFGKTFESHLTTEWRQQYMNYAELNAMIRTAVVNAPDVKVSRDSRYIRERDKNSDPEVLAYYQNFERNFFATCHQELSRVEDFFAH… |
| A0A0L8VMW5 | 1-205 | None |
| A0A5J4YVW5 | 154-301 | None |
| A0A4Y8DA85 | 9-215 | None |
| A0A3P6CLW8 | 1-183 | None |
| A0A7S3GFG7 | 1-192 | None |
| A0A080WND2 | 1-211 | None |
| A0A7J6U4G0 | 101-467 | None |
| A0A4P9Y407 | 30-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.