DPCstruct | MC37310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 411 ± 79 aa |
| Standard deviation of domain lengths | 79.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9W410 | 3-387 | DLNELWLNVLKIFPILGGEVTFPPDPIKDEVFENVYRQMSNMGIAKTITSILDMEVESAIRNVLVPKFWKHFISEGEPHKVKHDMNI… |
| A0A183VL27 | 4-278 | SALIPHFVTLSEKCNSSESISSVNLYHPLNDDSDHLRLLRLLIKLSEDLHNQLTSYLEPFCDSDFQILMNDGMIFSEIQDVVASLLI… |
| A0A814KBM9 | 3-316 | None |
| A0A699GRM5 | 14-458 | None |
| A0A0L6V8I9 | 31-528 | None |
| A0A2V1AKK2 | 11-351 | None |
| A0A5K3FBE7 | 19-409 | None |
| A0A835UI73 | 16-428 | None |
| I2GVN8 | 9-526 | None |
| A0A067GWC3 | 20-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.