DPCstruct | MC3731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 343 ± 47 aa |
| Standard deviation of domain lengths | 47.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 62.50 |
| Assigned Pfam label(s) | CL0184- CL0123- CL0193- CL0219- PF02805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6Z6Y1 | 342-594 | AYTYSKGNKETQWQTATDSENGLFEVVWAYFMKVSDGFSKLIPSVLTLIFMIASFALLSYAMKSLPLGTAYTVWTGIGAVGSFAVGI… |
| A0A2V8E9H8 | 1-327 | MPLISERESGDDARWRAVLARDRQSDGSFLYGVRSTGVYCRPSCPSRRPARAFVAFFESANEAEHAGFRPCKRCRPNDGNALDPWVE… |
| A0A7W2GAJ3 | 15-399 | None |
| A0A3D0L319 | 212-541 | None |
| A0A6L3SY91 | 332-709 | None |
| A0A537B8P9 | 2-324 | None |
| A0A539CVY6 | 11-362 | None |
| A0A1H7H6G8 | 1-428 | None |
| A0A2G4JDD1 | 1-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.