DPCstruct | MC37304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369S2G2 | 210-342 | IIRRYPTAIPTDYLLFDVRYGDGALANTFEDGIVLAENITNIISRSYPCEYTLTEMKQPNGNDVGNQLEAMEEICLITTIILQDYGK… |
| A0A7V0J6S0 | 1-137 | LDVKVGSGAFMKTIEDARLLAETMVGIGASHDTEVVAFLTNMDQPLGNEIGNASEIRESIDVLQGGGPPDLVEITYLLGREMLVLGG… |
| A0A3S5DT88 | 34-166 | None |
| L9JIS6 | 250-378 | None |
| A0A072NF47 | 178-309 | None |
| A0A3P8L2E1 | 2-151 | None |
| A0A662TV50 | 110-225 | None |
| A0A7C0VDM3 | 1-114 | None |
| F8LWR7 | 33-159 | None |
| D7DR96 | 259-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.