DPCstruct | MC37302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 497 |
|---|---|
| Mean domain length (aa) | 276 ± 54 aa |
| Standard deviation of domain lengths | 54.00 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 96.98 |
| Assigned Pfam label(s) | PF12142- CL0205- PF01161- PF14830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2XEG7 | 2-172 | ARPSLNDLNENDRALLAEEIQRYVTPDIVDIHWNAVLSGAHNDPAMFLSFHRDYISGLENFLSDRGYTQFVPLPAWNPKNPIPEEFN… |
| A0A010RYF3 | 443-726 | VSGTIALPVQDAPLRVEWRSLSSAAKADYISAVKCLDGLPSKIGLETSRYNDFPYVHAQLNNEIHFVAQFLPWHRYFVHIYETALRD… |
| A0A1S8VG51 | 7-199 | None |
| A0A7R9PVW4 | 525-816 | None |
| A0A1X6PJ49 | 348-643 | None |
| A0A0F7RVY0 | 296-620 | None |
| A0A6P8I080 | 46-313 | None |
| A0A7M5U0C1 | 259-570 | None |
| A0A6P8IFD5 | 272-534 | None |
| A0A2G8L6J4 | 527-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.