DPCstruct | MC37300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 186 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6LP82 | 1-81 | MEIYLVFVDAVLNSNKFWSAKVSGNNLTVEWGRIGYNSQQKIHFCSSHQQAVAKFNHIVTEKKAKGYRESQPQMDSSDVSE |
| F9ZUY2 | 8-89 | ELERWWVREWEKVLPEEGIFRFYRLALEQNLWGEWELTTSWGRIGRRPSRVLVRVLEDPAAAAPILENVERVRRKREYVPVQ |
| A0A4S3ZX22 | 203-271 | None |
| A0A7W0TBD1 | 9-86 | None |
| A0A259LIJ1 | 4-92 | None |
| A0A0F9NM25 | 107-189 | None |
| A0A7Y4ZH24 | 2-81 | None |
| A0A254TA72 | 10-83 | None |
| A0A0Q4XRX3 | 7-84 | None |
| A0A7W0QEP9 | 584-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.